PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g011650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 804aa    MW: 91079.4 Da    PI: 9.6005
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g011650.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B368.31.1e-2188183298
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     f v +++++lk++ + lpkk a++  ++ +++  ++l +e+g+sW+++l++r ++g+y++++GWk+F+++n+ kegD + F l+g+ e ++++ +
  Csa11g011650.1  88 FVVNVTASNLKTDTINLPKKAASSKALSRRCD-NIILVNEEGNSWTLNLRFRESDGSYYMGGGWKRFCSENKQKEGDLIAFNLVGDGESNPMLCI 181
                     5678899***************9999997776.*****************************************************9999****9 PP

                     E- CS
              B3  97 fr 98 
                     ++
  Csa11g011650.1 182 CS 183
                     97 PP

2B336.39.7e-122873571895
                     --HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  18 lpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     +p +f+ +h  g   +e+kt +l++  s  +We+k+  +++++   l  GWkeF++a++ + gD++vF+++g  +f ++v+
  Csa11g011650.1 287 IPVTFFLKHlqGR--NEHKTAKLRTgASDTVWELKI--EGGRR---LH-GWKEFARAHDFRIGDVIVFRHEG--DFVFHVT 357
                     999**99**7443..47789999997888*******..77764...55.********************766..5644665 PP

3B353.64.1e-17415506599
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      ++ ++l+++ +++p +fa+++g  k+++ +++l +e grsW++ l ++k++ +++l+ GW++F++ang++ g   +Fkl++ +++++v++++++
  Csa11g011650.1 415 NVSVSNLQEDKVYVPMSFARSNGWTKACG-KVVLLNEMGRSWNLSLDHDKSGIKTYLRHGWRSFCNANGMNRGGH-TFKLVQ-NSGTPVIRLCQA 506
                     56678889999***********9999998.****************999*9999*****************9985.999998.77779*999975 PP

4B3741.7e-23526617698
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     +++++++++ l+lpk f++++g++k +  +++l++e gr+W++ l++rk+ +++v+++GW+ F++ ngLk++D++ Fkl++ +++++v+ ++ 
  Csa11g011650.1 526 LTPSSFNNDALYLPKGFVSSNGLNKDCCDEMVLKNEYGRTWNLVLRHRKSNNTVVMSRGWRCFCEVNGLKARDSFKFKLVR-TGARPVLCLCP 617
                     4677888888********************************************************************998.88889998886 PP

5B357.82e-18703799199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++++ + + l+lp +f++ +g+kk++  ++tl +++g    v+l  +   gr  l+kGWk+F++a+++k g+++v++l++++++++v+k
  Csa11g011650.1 703 FVTLTITPYSYRDNKLRLPLHFTRVNGIKKPG--KITLLSQDGVNQMVRLLKDHDNGRLRLGKGWKGFCQAHNVKIGESFVLELIWKKDASPVLK 795
                     788899********************999766..8***************99999999************************************* PP

                     EE-S CS
              B3  96 vfrk 99 
                     ++ k
  Csa11g011650.1 796 FCTK 799
                     9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.5E-6865IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.1E-1882174IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.61E-1886174IPR015300DNA-binding pseudobarrel domain
CDDcd100177.70E-1787183No hitNo description
PROSITE profilePS5086314.52287185IPR003340B3 DNA binding domain
SMARTSM010193.5E-2388185IPR003340B3 DNA binding domain
PfamPF023627.6E-2088184IPR003340B3 DNA binding domain
PROSITE profilePS508636.245210283IPR003340B3 DNA binding domain
CDDcd100174.88E-9218293No hitNo description
SuperFamilySSF1019368.24E-9218293IPR015300DNA-binding pseudobarrel domain
PfamPF023621.5E-7218293IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.2E-8220283IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.2E-11277362IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-13287372IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.418287362IPR003340B3 DNA binding domain
CDDcd100174.29E-9287357No hitNo description
SuperFamilySSF1019363.14E-13287369IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.7E-18404508IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-16407511IPR015300DNA-binding pseudobarrel domain
CDDcd100173.76E-13411504No hitNo description
PROSITE profilePS5086312.055411507IPR003340B3 DNA binding domain
SMARTSM010191.4E-18412507IPR003340B3 DNA binding domain
PfamPF023622.2E-16414506IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-21514617IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-22517621IPR015300DNA-binding pseudobarrel domain
CDDcd100174.67E-19521617No hitNo description
PROSITE profilePS5086314.085521619IPR003340B3 DNA binding domain
SMARTSM010198.1E-29522619IPR003340B3 DNA binding domain
PfamPF023623.9E-22526618IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-19695799IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.47E-19697798IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.6E-26703800IPR003340B3 DNA binding domain
PfamPF023623.1E-18703799IPR003340B3 DNA binding domain
CDDcd100175.98E-16703788No hitNo description
PROSITE profilePS5086313.169703800IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 804 aa     Download sequence    Send to blast
MVNSLFQSPA NPHFFQPLLP GSETHLTIPV IFFSKHIDGK HEQKTAKLKS DSSEKTWEVK  60
MDGRNGLRKR NLNPKREAES FESWDYCFVV NVTASNLKTD TINLPKKAAS SKALSRRCDN  120
IILVNEEGNS WTLNLRFRES DGSYYMGGGW KRFCSENKQK EGDLIAFNLV GDGESNPMLC  180
ICSSYMGSFT IISRTKQICH SESHKLQYQK LQTCKLVDHD KRKVFTLPVE FTKINGINNN  240
HKKIILEDKH GVKRLIKLVR DGPNYGRRGL GKGWKLFCKA NDVLKNIPVT FFLKHLQGRN  300
EHKTAKLRTG ASDTVWELKI EGGRRLHGWK EFARAHDFRI GDVIVFRHEG DFVFHVTALG  360
LNSCEIEYST SSRSIDDDRD NHQDNIEIRP MKKRVKKNPR REEDSSSEHS CFVANVSVSN  420
LQEDKVYVPM SFARSNGWTK ACGKVVLLNE MGRSWNLSLD HDKSGIKTYL RHGWRSFCNA  480
NGMNRGGHTF KLVQNSGTPV IRLCQAGCKP DAESSSSDCS YFAGSLTPSS FNNDALYLPK  540
GFVSSNGLNK DCCDEMVLKN EYGRTWNLVL RHRKSNNTVV MSRGWRCFCE VNGLKARDSF  600
KFKLVRTGAR PVLCLCPAET KRDTKVVECS EGRDVDSLST DPSSGEESSE TEESEVKKNI  660
KDKGRDNNMF KEDSEEESIE DNIEKEKHCS RPGASSSSSQ SRFVTLTITP YSYRDNKLRL  720
PLHFTRVNGI KKPGKITLLS QDGVNQMVRL LKDHDNGRLR LGKGWKGFCQ AHNVKIGESF  780
VLELIWKKDA SPVLKFCTKS NSV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010438003.10.0PREDICTED: B3 domain-containing protein REM17-like
RefseqXP_010438004.10.0PREDICTED: B3 domain-containing protein REM17-like
TrEMBLR0F4H10.0R0F4H1_9BRAS; Uncharacterized protein
STRINGBra010225.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57811648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.11e-122B3 family protein